PDB entry 1k36

View 1k36 on RCSB PDB site
Description: NMR Structure of human Epiregulin
Class: hormone/growth factor
Keywords: EGF-like fold
Deposited on 2001-10-02, released 2003-09-30
The last revision prior to the SCOP 1.75 freeze date was dated 2004-02-17, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epiregulin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1k36a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k36A (A:)
    vsitkcssdmngyclhgqciylvdmsqnycrcevgytgvrcehffl