PDB entry 1k2p

View 1k2p on RCSB PDB site
Description: Crystal structure of Bruton's tyrosine kinase domain
Class: transferase
Keywords: Bruton tryosine kinase, kinase domain, TRANSFERASE
Deposited on 2001-09-28, released 2002-06-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1k2pa_
  • Chain 'B':
    Compound: Tyrosine-protein kinase BTK
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1k2pb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k2pA (A:)
    idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek
    lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
    flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
    ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
    kaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2pA (A:)
    idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek
    lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
    flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
    ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
    kaderptfkillsnildv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k2pB (B:)
    idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek
    lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
    flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
    ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
    kaderptfkillsnildvmdees
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2pB (B:)
    idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek
    lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
    flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
    ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
    kaderptfkillsnildv