PDB entry 1k2d

View 1k2d on RCSB PDB site
Description: Crystal structure of the autoimmune MHC class II I-Au complexed with myelin basic protein 1-11 at 2.2A
Deposited on 2001-09-26, released 2003-03-04
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-04, with a file datestamp of 2003-03-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k2dA (A:)
    hsrgeddieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlr
    sfdpqgglqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdni
    fppvinitwlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwglee
    pvlkhwepe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2dA (A:)
    ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
    lqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k2dB (B:)
    gdserhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaey
    ynkqylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtd
    fypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslk
    spitvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2dB (B:)
    rhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyynkq
    ylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtdfypa
    kikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslkspit
    vewra