PDB entry 1k28

View 1k28 on RCSB PDB site
Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device
Class: hydrolase/structural protein
Keywords: Triple-stranded beta-helix, OB fold, pseudohexamer, T4 tail lysozyme, HUB, gp27-gp5*-gp5C, HYDROLASE-STRUCTURAL PROTEIN COMPLEX
Deposited on 2001-09-26, released 2002-02-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.211
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tail-associated lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16009 (Start-574)
      • expression tag (575)
      • expression tag (582-583)
    Domains in SCOPe 2.01: d1k28a1, d1k28a2, d1k28a3
  • Chain 'D':
    Compound: Baseplate structural protein Gp27
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: 27
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17172
      • modified residue (39)
      • modified residue (50)
      • modified residue (63)
      • modified residue (134)
      • see remark 999 (167)
      • modified residue (192)
      • modified residue (196-197)
      • modified residue (201-202)
      • modified residue (210)
      • modified residue (247)
      • see remark 999 (261)
      • modified residue (264)
      • modified residue (285)
      • modified residue (300)
      • see remark 999 (307)
      • modified residue (356)
    Domains in SCOPe 2.01: d1k28d1, d1k28d2
  • Heterogens: K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k28A (A:)
    memisnnlnwfvgvvedrmdplklgrvrvrvvglhppqraqgdvmgipteklpwmsviqp
    itsaamsgiggsvtgpvegtrvyghfldkwktngivlgtyggivrekpnrlegfsdptgq
    yprrlgndtnvlnqggevgydsssnviqdsnldtainpddrplseiptddnpnmsmaeml
    rrdeglrlkvywdtegyptigighlimkqpvrdmaqinkvlskqvgreitgnpgsitmee
    attlferdladmqrdikshskvgpvwqavnrsrqmalenmafqmgvggvakfntmltaml
    agdwekaykagrdslwyqqtkgrasrvtmiiltgnlesygvevktparslsamaatvaks
    sdpadppipndsrilfkepvssykgeypyvhtmetesghiqefddtpgqeryrlvhptgt
    yeevspsgrrtrktvdnlyditnadgnflvagdkktnvggseiyynmdnrlhqidgsnti
    fvrgdetktvegngtilvkgnvtiivegnaditvkgdattlvegnqtntvngnlswkvag
    tvdwdvggdwtekmasmssissgqytidgsridigsvdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k28A (A:)
    nnlnwfvgvvedrmdplklgrvrvrvvglhppqraqgdvmgipteklpwmsviqpitsaa
    msgiggsvtgpvegtrvyghfldkwktngivlgtyggivrekpnrlegfsdptgqyprrl
    gndtnvlnqggevgydsssnviqdsnldtainpddrplseiptddnpnmsmaemlrrdeg
    lrlkvywdtegyptigighlimkqpvrdmaqinkvlskqvgreitgnpgsitmeeattlf
    erdladmqrdikshskvgpvwqavnrsrqmalenmafqmgvggvakfntmltamlagdwe
    kaykagrdslwyqqtkgrasrvtmiiltgnlesygvevktdpadppipndsrilfkepvs
    sykgeypyvhtmetesghiqefddtpgqeryrlvhptgtyeevspsgrrtrktvdnlydi
    tnadgnflvagdkktnvggseiyynmdnrlhqidgsntifvrgdetktvegngtilvkgn
    vtiivegnaditvkgdattlvegnqtntvngnlswkvagtvdwdvggdwtekmasmssis
    sgqytidgsridigshh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k28D (D:)
    msmlqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydskni
    htkmdgneiiqisvanandinnvktriygckhfsvsvdskgdniiaielgtihsienlkf
    grpffpdagesikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalav
    gsdkfvfvwqdimgvnmmdydmminqepypmivgepsligqfiqelkyplaydfvwltks
    nphkrdpmknatiyahsfldssipmittgkgensivvsrsgaysemtyrngyeeairlqt
    maqydgyakcstignfnltpgvkiifndsknqfktefyvdevihelsnnnsvthlymftn
    atkletidpvkvknefksdttteessssnkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k28D (D:)
    lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
    mdgneiiqisvanandinnvktriygckhfsvsvdskgdniiaielgtihsienlkfgrp
    ffpdagesikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsd
    kfvfvwqdimgvnmmdydmminqepypmivgepskyplaydfvwltksnphkrdpmknat
    iyahsfldssipmittgkgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcst
    ignfnltpgvkiifndsknqfktefyvdevihelsnnnsvthlymftnatkletidpvkv
    knef