PDB entry 1k1s

View 1k1s on RCSB PDB site
Description: Crystal Structure of DinB from Sulfolobus solfataricus
Deposited on 2001-09-25, released 2001-10-31
The last revision prior to the SCOP 1.67 freeze date was dated 2001-10-31, with a file datestamp of 2001-10-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k1sA (A:)
    mivifvdfdyffaqveevlnpqykgkplvvsvysgrtktsgavatanyearklgvkagmp
    iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
    ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
    ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepven
    kskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgk
    kfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiinktnlsdffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1sA (A:)
    mivifvdfdyffaqveevlnpqykgkplvvsvysgtsgavatanyearklgvkagmpiik
    amqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengi
    elarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldide
    ipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepvenksk
    iphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgkkfk
    hgisidnaykvaedllrellvrdkrrnvrrigvkldniiin