PDB entry 1k19

View 1k19 on RCSB PDB site
Description: NMR Solution Structure of the Chemosensory Protein CSP2 from Moth Mamestra brassicae
Deposited on 2001-09-24, released 2002-12-04
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1k19a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k19A (A:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee