PDB entry 1k0r

View 1k0r on RCSB PDB site
Description: Crystal Structure of Mycobacterium tuberculosis NusA
Deposited on 2001-09-20, released 2001-12-21
The last revision prior to the SCOP 1.69 freeze date was dated 2001-12-21, with a file datestamp of 2001-12-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.248
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k0rA (A:)
    mgsshhhhhhssglvsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghq
    tdarieidrktgvvrviaretdeagnlisewddtpegfgriaattarqvmlqrfrdaene
    rtygefstregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgn
    rlrcyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsveivavareaghrskia
    vrsnvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspakvvsvs
    vidqtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapppppgqpepgvsr
    gmahdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0rA (A:)
    vsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghqtdarieidrktgvv
    rviaretdeagnlisewddtpegfgriaattarqvmlqrfrdaestregeivagviqrds
    ranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyvvgvtrgareplitlsr
    thpnlvrklfslevpeiadgsveivavareaghrskiavrsnvaglnakgacigpmgqrv
    rnvmselsgekidiidydddparfvanalspakvvsvsvidqtaraarvvvpdfqlslai
    gkegqnarlaarltgwridirgdapp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k0rB (B:)
    mgsshhhhhhssglvsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghq
    tdarieidrktgvvrviaretdeagnlisewddtpegfgriaattarqvmlqrfrdaene
    rtygefstregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgn
    rlrcyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsveivavareaghrskia
    vrsnvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspakvvsvs
    vidqtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapppppgqpepgvsr
    gmahdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0rB (B:)
    vsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghqtdarieidrktgvv
    rviaretdeagnlisewddtpegfgriaattarqvmlqrfrdaestregeivagviqrds
    ranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyvvgvtrgareplitlsr
    thpnlvrklfslevpeiadgsveivavareaghrskiavrsnvaglnakgacigpmgqrv
    rnvmselsgekidiidydddparfvanalspakvvsvsvidqtaraarvvvpdfqlslai
    gkegqnarlaarltgwridirgdapp