PDB entry 1k0k

View 1k0k on RCSB PDB site
Description: Yeast Profilin, Cubic Crystal Form
Deposited on 2001-09-19, released 2001-10-03
The last revision prior to the SCOP 1.69 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1k0ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k0kA (A:)
swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
igvqy