PDB entry 1k00

View 1k00 on RCSB PDB site
Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria
Deposited on 2001-09-17, released 2001-10-26
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-26, with a file datestamp of 2001-10-26.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.273
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1k00a_
  • Chain 'K':
    Domains in SCOP 1.59: d1k00k_
  • Chain 'L':
    Domains in SCOP 1.59: d1k00l_
  • Chain 'M':
    Domains in SCOP 1.59: d1k00m_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k00K (K:)
    aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
    kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
    gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
    rhdrlvidaaaleivee
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k00L (L:)
    eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
    sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
    tiivaekgnk
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k00M (M:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla