PDB entry 1jyr

View 1jyr on RCSB PDB site
Description: Xray Structure of Grb2 SH2 Domain Complexed with a Phosphorylated Peptide
Class: signaling protein/inhibitor
Keywords: receptor binding, regulatory, inhibitor, SIGNALING PROTEIN-INHIBITOR COMPLEX
Deposited on 2001-09-13, released 2002-03-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.19
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Growth factor receptor-bound protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62993 (4-95)
    • cloning artifact (0-3)
  Domains in SCOPe 2.04: d1jyra_
• Chain 'L':
  Compound: peptide: PSpYVNVQN
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1JYR (0-8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jyrA (A:)
  gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
  gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi
  

  
  
• Chain 'L':
  No sequence available.