PDB entry 1jyr

View 1jyr on RCSB PDB site
Description: Xray Structure of Grb2 SH2 Domain Complexed with a Phosphorylated Peptide
Class: signaling protein
Keywords: receptor binding, regulatory, inhibitor
Deposited on 2001-09-13, released 2002-03-13
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.19
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62993 (4-95)
      • cloning artifact (0-3)
    Domains in SCOP 1.75: d1jyra_
  • Chain 'L':
    Compound: peptide: PSpYVNVQN
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jyrA (A:)
    gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi
    

  • Chain 'L':
    No sequence available.