PDB entry 1jyq

View 1jyq on RCSB PDB site
Description: xray structure of grb2 sh2 domain complexed with a highly affine phospho peptide
Deposited on 2001-09-13, released 2002-03-13
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1jyqa_
  • Chain 'B':
    Domains in SCOP 1.65: d1jyqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jyqA (A:)
gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jyqB (B:)
gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi