PDB entry 1jyf

View 1jyf on RCSB PDB site
Description: Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion.
Class: transcription
Keywords: Gene Regulation, Protein Stability, Protein DNA-binding, TRANSCRIPTION
Deposited on 2001-09-12, released 2001-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • see remark 999 (108)
    Domains in SCOPe 2.06: d1jyfa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jyfA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jyfA (A:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlapn