PDB entry 1jye

View 1jye on RCSB PDB site
Description: Structure of a Dimeric Lac Repressor with C-terminal Deletion and K84L Substitution
Class: transcription
Keywords: Gene Regulation, Protein Stability, Protein DNA-binding
Deposited on 2001-09-12, released 2001-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2001-10-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.223
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: Escherichia coli
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • engineered (83)
      • see remark 999 (108)
    Domains in SCOP 1.73: d1jyea_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jyeA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaailsradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jyeA (A:)
    lligvatsslalhapsqivaailsradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttlap