PDB entry 1jyb

View 1jyb on RCSB PDB site
Description: Crystal structure of Rubrerythrin
Class: electron transport
Keywords: alpha helix bundle, ELECTRON TRANSPORT
Deposited on 2001-09-11, released 2002-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jyba1, d1jyba2
  • Heterogens: FE, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jybA (A:)
    mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
    fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
    fasiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahp
    kahfellginw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jybA (A:)
    kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
    kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
    asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
    ahfellginw