PDB entry 1jy3

View 1jy3 on RCSB PDB site
Description: Crystal Structure of the Central Region of Bovine Fibrinogen (E5 Fragment) at 1.4 Angstroms Resolution
Class: blood clotting
Keywords: fibrinogen, fragment E, disulfide bonds, asymmetry, coiled-coil, beta-sheet, BLOOD CLOTTING
Deposited on 2001-09-10, released 2001-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Compound: fibrinogen alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JY3
    Domains in SCOPe 2.07: d1jy3n_
  • Chain 'O':
    Compound: fibrinogen beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jy3o_
  • Chain 'P':
    Compound: fibrinogen gamma-b chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jy3p_
  • Chain 'Q':
    Compound: fibrinogen alpha chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JY3
    Domains in SCOPe 2.07: d1jy3q_
  • Chain 'R':
    Compound: fibrinogen beta chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jy3r_
  • Chain 'S':
    Compound: fibrinogen gamma-b chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jy3s_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1jy3N (N:)
    sacketgwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfnyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy3N (N:)
    gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfn
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1jy3O (O:)
    kverkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsvsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy3O (O:)
    rkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1jy3P (P:)
    yvatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy3P (P:)
    vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegil
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1jy3Q (Q:)
    sacketgwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfnyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy3Q (Q:)
    gwpfcsdedwntkcpsgcrmkglidevdqdftsrinklrdslfn
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1jy3R (R:)
    kverkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsvsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy3R (R:)
    rkppdadgclhadpdlgvlcptgcklqdtlvrqerpirksiedlrntvdsv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1jy3S (S:)
    yvatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jy3S (S:)
    vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily