PDB entry 1jxp

View 1jxp on RCSB PDB site
Description: bk strain hepatitis c virus (hcv) ns3-ns4a
Deposited on 1997-08-21, released 1998-01-14
The last revision prior to the SCOP 1.61 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.245
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jxp.1
  • Chain 'B':
    Domains in SCOP 1.61: d1jxp.2
  • Chain 'C':
    Domains in SCOP 1.61: d1jxp.1
  • Chain 'D':
    Domains in SCOP 1.61: d1jxp.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxpA (A:)
    itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
    tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
    rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxpB (B:)
    itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
    tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
    rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxpC (C:)
    gsvvivgriils
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jxpD (D:)
    gsvvivgriils