PDB entry 1jx6

View 1jx6 on RCSB PDB site
Description: crystal structure of luxp from vibrio harveyi complexed with autoinducer-2
Class: signaling protein
Keywords: protein-ligand complex, signaling protein
Deposited on 2001-09-05, released 2002-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.214
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: luxp protein
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jx6a_
  • Heterogens: CA, AI2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jx6A (A:)
    vlngywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywv
    rniasfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkf
    vehvldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysv
    lyfsegyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiya
    cstdvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeai
    kwdledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx6A (A:)
    gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
    asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
    vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
    segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
    dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
    ledkpvptvysgdfeivtkadsperiealkkrafrysd