PDB entry 1jx2

View 1jx2 on RCSB PDB site
Description: crystal structure of the nucleotide-free dynamin a gtpase domain, determined as myosin fusion
Class: hydrolase
Keywords: dynamin, GTPase, myosin, fusion-protein, Dictyostelium, HYDROLASE
Deposited on 2001-09-05, released 2001-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin II heavy chain
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08799 (13-775)
      • expression tag (12)
      • see remark 999 (259)
      • see remark 999 (322)
    Domains in SCOPe 2.06: d1jx2a1, d1jx2a2, d1jx2a3
  • Chain 'B':
    Compound: Dynamin A GTPase domain
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: dymA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jx2b_
  • Chain 'C':
    Compound: Linker Peptide
    Species: Dictyostelium discoideum [TaxId:44689]
  • Heterogens: BGC, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jx2A (A:)
    mhhhhhhhdgtedpihdrtsdyhkylkvkqgdsdlfkltvsdkryiwynpdpkerdsyec
    geivsetsdsftfktvdgqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvr
    ynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmldd
    rqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnak
    ttrnnnssrfgkfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagat
    aeekkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiia
    gilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhl
    nvekssssrdalvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeql
    cinytneklqqffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilall
    deqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknk
    dplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettn
    phfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryylla
    pnvprdaedsqkatdavlkhlnidpeqyrfgitkiffragqlarieeareqrisei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx2A (A:)
    dpihdrtsdyhkylkvkqfkltvsdkryiwynpdpkerdsyecgeivsetsdsftfktvd
    gqdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvrynqdliytysglflvav
    npfkripiytqemvdifkgrrrnevaphifaisdvayrsmlddrqnqsllitgesgagkt
    entkkviqylasvagsgvleqqilqanpileafgnakttrnnnssrfgkfieiqfnsagf
    isgasiqsylleksrvvfqseternyhifyqllagataeekkalhlagpesfnylnqsgc
    vdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlgnikfekgagegavlkdk
    talnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekssssrdalvkalygrlflw
    lvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytneklqqffnhhmfkleqe
    eylkekinwtfidfgldsqatidlidgrqppgilalldeqsvfpnatdntlitklhshfs
    kknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqdlelcfkdssdnvvtklf
    ndpniasrakkganfitvaaqykeqlaslmatlettnphfvrciipnnkqlpakledkvv
    ldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprdaedsqkatdavlkhlni
    dpeqyrfgitkiffragqlarieeareqrisei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jx2B (B:)
    dqlipvinklqdvfntlgsdpldlpqivvvgsqssgkssvlenivgrdflprgsgivtrr
    plilqlthlpiaddgsqtqewgeflhkpndmfydfseireeiirdtdrmtgknkgisaqp
    inlkiysphvvnltlvdlpgitkvpvgdqptdieqqirrmvmayikkqnaiivavtpant
    dlansdalqlakevdpegkrtigvitkldlmdkgtdamevltgrvipltlgfigvinrsq
    ediiakksireslkseilyfknhpiyksianrsgtaylsktlnkllmfhirdtlpdlkvk
    vskmlsdvqgelsty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jx2B (B:)
    dqlipvinklqdvfntlgsdpldlpqivvvgsqssgkssvlenivgrdflprplilqlth
    lpiaddgsqtqewgeflhkpndmfydfseireeiirdtdisaqpinlkiysphvvnltlv
    dlpgitdieqqirrmvmayikkqnaiivavtpantdlansdalqlakevdpegkrtigvi
    tkldlmdkgtdamevltgrvipltlgfigvinrsqediiakksireslkseilyfknhpi
    yksianrsgtaylsktlnkllmfhirdtlpdlkvkvskmls
    

  • Chain 'C':
    No sequence available.