PDB entry 1jwx

View 1jwx on RCSB PDB site
Description: Chalcone Synthase--F215S mutant
Class: transferase
Keywords: polyketide synthase, altered substrate specificity, ketoacyl synthase, TRANSFERASE
Deposited on 2001-09-05, released 2002-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.2
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chalcone synthase 2
    Species: Medicago sativa [TaxId:3879]
    Gene: CHS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30074 (Start-388)
      • modified residue (163)
      • engineered (214)
    Domains in SCOPe 2.07: d1jwxa1, d1jwxa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jwxA (A:)
    mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
    dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
    kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen
    nkgarvlvvcsevtavtfrgpsdthldslvgqalsgdgaaalivgsdpvpeiekpifemv
    wtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifw
    iahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglkt
    tgeglewgvlfgfgpgltietvvlrsvai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwxA (A:)
    vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
    ksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpk
    skithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaenn
    kgarvlvvcsevtavtfrgpsdthldslvgqalsgdgaaalivgsdpvpeiekpifemvw
    taqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdynsifwi
    ahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstqnglktt
    geglewgvlfgfgpgltietvvlrsvai