PDB entry 1jwl

View 1jwl on RCSB PDB site
Description: Structure of the Dimeric lac Repressor/Operator O1/ONPF Complex
Class: transcription/DNA
Keywords: Lac Repressor, Gene Regulation, DNA-Bending
Deposited on 2001-09-04, released 2001-10-05
The last revision prior to the SCOP 1.73 freeze date was dated 2001-10-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.249
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: Escherichia coli
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • see remark 999 (108)
    Domains in SCOP 1.73: d1jwla1, d1jwla2
  • Chain 'B':
    Compound: lactose operon repressor
    Species: Escherichia coli
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • see remark 999 (108)
    Domains in SCOP 1.73: d1jwlb1, d1jwlb2
  • Chain 'C':
    Compound: lactose operon repressor
    Species: Escherichia coli
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • see remark 999 (108)
    Domains in SCOP 1.73: d1jwlc_
  • Chain 'D':
    Compound: 5'-d(*ap*gp*ap*ap*t*tp*gp*tp*gp*ap*gp*cp*gp*gp*ap*tp*ap*ap*cp*ap*ap*tp*t)-3'
  • Chain 'E':
    Compound: 5'-d(*tp*ap*ap*tp*tp*gp*tp*tp*ap*tp*cp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*tp*c)-3'
  • Heterogens: NPF

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jwlA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwlA (A:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkqs
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jwlB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwlB (B:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkqs
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jwlC (C:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwlC (C:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttl
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.