PDB entry 1jwb

View 1jwb on RCSB PDB site
Description: Structure of the Covalent Acyl-Adenylate Form of the MoeB-MoaD Protein Complex
Class: ligase
Keywords: MoeB: modified Rossmann fold; (2) Cys-X-X-Cys Zinc-binding motifs; MoaD: ubiquitin-like fold
Deposited on 2001-09-03, released 2001-11-21
The last revision prior to the SCOP 1.75 freeze date was dated 2001-11-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: molybdopterin biosynthesis moeb protein
    Species: Escherichia coli
    Gene: MoeB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jwbb_
  • Chain 'D':
    Compound: molybdopterin [mpt] converting factor, subunit 1
    Species: Escherichia coli
    Gene: MoaD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jwbd_
  • Heterogens: ZN, SO4, AMP, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jwbB (B:)
    maelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltl
    ldfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaalia
    ehdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlf
    genaltcveagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmr
    npgcevcgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwbB (B:)
    aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll
    dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae
    hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlfg
    eagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmrnpgcevcg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jwbD (D:)
    mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
    sfdhpltdgdevaffppvtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwbD (D:)
    ikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlvs
    fdhpltdgdevaffppvtgg