PDB entry 1jw8

View 1jw8 on RCSB PDB site
Description: 1.3 angstrom resolution crystal structure of p6 form of myoglobin
Class: oxygen storage/transport
Keywords: anisotropic refinement myoglobin
Deposited on 2001-09-03, released 2001-10-10
The last revision prior to the SCOP 1.73 freeze date was dated 2001-10-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.135
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Gene: MB (Synthesized)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • see remark 999 (0)
      • see remark 999 (122)
    Domains in SCOP 1.73: d1jw8a_
  • Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jw8A (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg