PDB entry 1jvk

View 1jvk on RCSB PDB site
Description: three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor
Deposited on 2001-08-30, released 2002-05-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-03, with a file datestamp of 2002-05-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvkA (A:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvkB (B:)
    etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
    sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapta