PDB entry 1jv9

View 1jv9 on RCSB PDB site
Description: nmr structure of bpti mutant g37a
Deposited on 2001-08-28, released 2001-09-12
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jv9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jv9A (A:)
    rpdfcleppytgpckariiryfynakaglcqtfvygacrakrnnfksaedcmrtcgga