PDB entry 1jv8

View 1jv8 on RCSB PDB site
Description: NMR Structure of BPTI Mutant G37A
Class: blood clotting
Keywords: BPTI, G37A Mutant, Conformational Strain
Deposited on 2001-08-28, released 2001-09-12
The last revision prior to the SCOP 1.73 freeze date was dated 2002-02-27, with a file datestamp of 2007-06-04.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: trypsin inhibitor
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00974 (0-57)
    • engineered (36)
  Domains in SCOP 1.73: d1jv8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jv8A (A:)
  rpdfcleppytgpckariiryfynakaglcqtfvygacrakrnnfksaedcmrtcgga