PDB entry 1jv7

View 1jv7 on RCSB PDB site
Description: bacteriorhodopsin o-like intermediate state of the d85s mutant at 2.25 angstrom resolution
Deposited on 2001-08-28, released 2001-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 2001-10-31, with a file datestamp of 2001-10-31.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1jv7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jv7A (A:)
    ewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygltm
    vpfggeqnpiywaryaswlfttplllldlallvdadqgtilalvgadgimigtglvgalt
    kvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvv
    wligsegagivplnietllfmvldvsakvgfglillrsraifge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jv7A (A:)
    ewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgiywar
    yaswlfttplllldlallvdadqgtilalvgadgimigtglvgaltkvysyrfvwwaist
    aamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvvwligsegagivpln
    ietllfmvldvsakvgfglillrsraifge