PDB entry 1jv0

View 1jv0 on RCSB PDB site
Description: the crystal structure of the zinc(II) adduct of the cai michigan 1 variant
Class: lyase
Keywords: 10-stranded-beta-sheet, lyase
Deposited on 2001-08-28, released 2001-09-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00915 (Start-259)
      • engineered (66)
    Domains in SCOPe 2.03: d1jv0a_
  • Chain 'B':
    Compound: carbonic anhydrase I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00915 (Start-259)
      • engineered (66)
    Domains in SCOPe 2.03: d1jv0b_
  • Heterogens: ZN, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jv0A (A:)
    aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
    nvghsfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
    ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
    pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
    mqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jv0A (A:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jv0B (B:)
    aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
    nvghsfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
    ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
    pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
    mqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jv0B (B:)
    wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
    sfrvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
    sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
    lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
    nrptqplkgrtvrasf