PDB entry 1jug

View 1jug on RCSB PDB site
Description: lysozyme from echidna milk (tachyglossus aculeatus)
Class: lysozyme
Keywords: lysozyme, calcium-binding
Deposited on 1996-10-13, released 1997-04-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Tachyglossus aculeatus [TaxId:9261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1juga_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jugA (A:)
    kilkkqelcknlvaqgmngyqhitlpnwvctafhessyntratnhntdgstdygilqins
    rywchdgktpgsknacniscskllddditddlkcakkiageakgltpwvawkskcrghdl
    skfkc