PDB entry 1jug

View 1jug on RCSB PDB site
Description: lysozyme from echidna milk (tachyglossus aculeatus)
Class: lysozyme
Keywords: lysozyme, calcium-binding
Deposited on 1996-10-13, released 1997-04-21
The last revision prior to the SCOP 1.73 freeze date was dated 1997-04-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Tachyglossus aculeatus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P37156 (0-124)
  Domains in SCOP 1.73: d1juga_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jugA (A:)
  kilkkqelcknlvaqgmngyqhitlpnwvctafhessyntratnhntdgstdygilqins
  rywchdgktpgsknacniscskllddditddlkcakkiageakgltpwvawkskcrghdl
  skfkc