PDB entry 1jug

View 1jug on RCSB PDB site
Description: lysozyme from echidna milk (tachyglossus aculeatus)
Deposited on 1996-10-13, released 1997-04-21
The last revision prior to the SCOP 1.69 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1jug__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jug_ (-)
    kilkkqelcknlvaqgmngyqhitlpnwvctafhessyntratnhntdgstdygilqins
    rywchdgktpgsknacniscskllddditddlkcakkiageakgltpwvawkskcrghdl
    skfkc