PDB entry 1juf

View 1juf on RCSB PDB site
Description: Structure of Minor Histocompatibility Antigen peptide, H13b, complexed to H2-Db
Class: immune system
Keywords: MHC Class-I, H2-Db, H13, Minor histocompatibility antigens, IMMUNE SYSTEM
Deposited on 2001-08-24, released 2002-03-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H2-Db major histocompatibility antigen
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01899 (0-275)
      • conflict (275)
    Domains in SCOPe 2.02: d1jufa1, d1jufa2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: BETA-2-MICROGLOBULIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1jufb_
  • Chain 'C':
    Compound: H13b peptide
    Species: Mus musculus [TaxId:10090]
    Gene: H13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D8V0 (0-8)
      • conflict (3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jufA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltlrwer
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jufB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.