PDB entry 1jtp

View 1jtp on RCSB PDB site
Description:
Deposited on 2001-08-21, released 2001-12-05
The last revision prior to the SCOP 1.71 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1jtpa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1jtpb_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1jtpl_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1jtpm_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jtpA (A:)
    dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
    adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
    dswgqgtqvtvssrrypydvpdygsgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtpA (A:)
    dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
    adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
    dswgqgtqvtvssrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jtpB (B:)
    dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
    adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
    dswgqgtqvtvssrrypydvpdygsgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jtpB (B:)
    dvqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityy
    adsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygy
    dswgqgtqvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jtpL (L:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jtpM (M:)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl