PDB entry 1jt9

View 1jt9 on RCSB PDB site
Description: structure of the mutant f174a t form of the glucosamine-6-phosphate deaminase from e.coli
Deposited on 2001-08-20, released 2002-02-20
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-20, with a file datestamp of 2002-02-20.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jt9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jt9A (A:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrfadndvnq
    vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
    epstmelkvktlryfneleaenikgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jt9A (A:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlpkyaltvgvgtlldaeev
    milvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcdepstmelkvktlryfnele
    aenikgl