PDB entry 1jsp

View 1jsp on RCSB PDB site
Description: NMR Structure of CBP Bromodomain in complex with p53 peptide
Class: DNA binding protein
Keywords: Bromodomain, CBP, NMR structure., DNA BINDING PROTEIN
Deposited on 2001-08-17, released 2002-08-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tumor protein p53
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-19)
    • modified residue (15)
• Chain 'B':
  Compound: creb-binding protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92793 (4-120)
    • cloning artifact (0-3)
  Domains in SCOPe 2.02: d1jspb_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jspB (B:)
  gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
  tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
  g