PDB entry 1jsp

View 1jsp on RCSB PDB site
Description: nmr structure of cbp bromodomain in complex with p53 peptide
Deposited on 2001-08-17, released 2002-08-17
The last revision prior to the SCOP 1.61 freeze date was dated 2002-08-17, with a file datestamp of 2002-08-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.61: d1jspb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jspB (B:)
gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls
tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
g