PDB entry 1jsf

View 1jsf on RCSB PDB site
Description: full-matrix least-squares refinement of human lysozyme
Deposited on 1998-01-05, released 1998-04-29
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.115
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1jsf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jsf_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv