PDB entry 1jr9

View 1jr9 on RCSB PDB site
Description: Crystal Structure of manganese superoxide dismutases from Bacillus halodenitrificans
Class: oxidoreductase
Keywords: manganese superoxide dismutase, oxidoreductase
Deposited on 2001-08-13, released 2002-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Virgibacillus halodenitrificans [TaxId:1482]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jr9a1, d1jr9a2
  • Heterogens: MN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jr9A (A:)
    akfelpelpyaydaleptidketmnihhtkhhntyvtklngaleghedlknkslndlisn
    ldavpenirtavrnnggghanhslfwklmspngggkptgevadkindkygsfekfqeefa
    aaaagrfgsgwawlvvnngeieimstpiqdnplmegkkpilgldvwehayylkyqnkrpd
    yisafwnvvnwdevaaqysqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jr9A (A:)
    kfelpelpyaydaleptidketmnihhtkhhntyvtklngaleghedlknkslndlisnl
    davpenirtavrnnggghanhslfwklmspngggkptgevadkindkygsfekfqeefaa
    aaagrfgsgwawlvvnngeieimstpiqdnplmegkkpilgldvwehayylkyqnkrpdy
    isafwnvvnwdevaaqysqaa