PDB entry 1jqw

View 1jqw on RCSB PDB site
Description: the 2.3 angstrom resolution structure of bacillus subtilis luxs/homocysteine complex
Deposited on 2001-08-09, released 2001-10-24
The last revision prior to the SCOP 1.71 freeze date was dated 2001-10-24, with a file datestamp of 2001-10-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jqwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqwA (A:)
    mpsvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehll
    aftirshaekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipa
    anekqcgqaklhdlegakrlmrfwlsqdkeellkvfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqwA (A:)
    eldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaftirsh
    aekydhfdiidispmgcqtgyylvvsgettsaeivdlledtmkeaveiteipaanekqcg
    qaklhdlegakrlmrfwlsqdkeellkvfg