PDB entry 1jqh

View 1jqh on RCSB PDB site
Description: IGF-1 receptor kinase domain
Class: transferase
Keywords: protein kinase fold, TRANSFERASE
Deposited on 2001-08-07, released 2002-04-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IGF-1 receptor kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1jqha_
  • Chain 'B':
    Compound: IGF-1 receptor kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1jqhb_
  • Chain 'C':
    Compound: IGF-1 receptor kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1jqhc_
  • Heterogens: MG, SO4, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqhA (A:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhA (A:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlapps
    lskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllp
    vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
    ncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jqhB (B:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhB (B:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpppslskm
    iqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllpvrwm
    speslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpdncpd
    mlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jqhC (C:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhC (C:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlapps
    lskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllp
    vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
    ncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk