PDB entry 1jqh

View 1jqh on RCSB PDB site
Description: IGF-1 receptor kinase domain
Class: transferase
Keywords: protein kinase fold
Deposited on 2001-08-07, released 2002-04-19
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IGF-1 receptor kinase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jqha_
  • Chain 'B':
    Compound: IGF-1 receptor kinase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jqhb_
  • Chain 'C':
    Compound: IGF-1 receptor kinase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1jqhc_
  • Heterogens: MG, SO4, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqhA (A:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhA (A:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlapps
    lskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllp
    vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
    ncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jqhB (B:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhB (B:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpppslskm
    iqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllpvrwm
    speslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpdncpd
    mlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jqhC (C:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhC (C:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlapps
    lskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllp
    vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
    ncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk