PDB entry 1jqh

View 1jqh on RCSB PDB site
Description: IGF-1 receptor kinase domain
Deposited on 2001-08-07, released 2002-04-19
The last revision prior to the SCOP 1.71 freeze date was dated 2002-04-19, with a file datestamp of 2002-04-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jqha_
  • Chain 'B':
    Domains in SCOP 1.71: d1jqhb_
  • Chain 'C':
    Domains in SCOP 1.71: d1jqhc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqhA (A:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhA (A:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlapps
    lskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllp
    vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
    ncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jqhB (B:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhB (B:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpppslskm
    iqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllpvrwm
    speslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpdncpd
    mlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jqhC (C:)
    gsfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvnea
    asmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpem
    ennpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtr
    diyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsn
    eqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevs
    fyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqhC (C:)
    advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
    rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlapps
    lskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllp
    vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
    ncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk