PDB entry 1jqa

View 1jqa on RCSB PDB site
Description: Bacillus stearothermophilus glycerol dehydrogenase complex with glycerol
Class: oxidoreductase
Keywords: Oxidoreductase, NAD, Glycerol metabolism
Deposited on 2001-08-04, released 2001-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.158
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GLDA or GLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32816
      • engineered (304)
    Domains in SCOPe 2.05: d1jqaa_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jqaA (A:)
    maaervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgnia
    aeevvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaa
    stdaptsalsviysddgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwve
    arsviksggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveant
    llsglgfesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryi
    elylcldlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqy
    akaykekhrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jqaA (A:)
    aervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaae
    evvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaast
    daptsalsviyvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvearsvik
    sggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantllsglg
    fesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryielylcl
    dlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqyakayke
    k