PDB entry 1jq4

View 1jq4 on RCSB PDB site
Description: [2Fe-2S] Domain of Methane Monooxygenase Reductase from Methylococcus capsulatus (Bath)
Class: oxidoreductase
Keywords: [2Fe-2S] ferredoxin, OXIDOREDUCTASE
Deposited on 2001-08-03, released 2002-01-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: methane monooxygenase component c
  Species: Methylococcus capsulatus str. Bath [TaxId:243233]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22868 (0-97)
  Domains in SCOPe 2.04: d1jq4a_
• Heterogens: FES

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jq4A (A:)
  mqrvhtitavtedgeslrfecrsdedvitaalrqniflmsscreggcatckalcsegdyd
  lkgcsvqalppeeeeeglvllcrtypktdleielpyth