PDB entry 1jpt

View 1jpt on RCSB PDB site
Description: crystal structure of fab d3h44
Deposited on 2001-08-03, released 2002-02-03
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-03, with a file datestamp of 2002-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jptH (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jptH (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jptL (L:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge