PDB entry 1jpa

View 1jpa on RCSB PDB site
Description: Crystal Structure of unphosphorylated EphB2 receptor tyrosine kinase and juxtamembrane region
Class: transferase
Keywords: receptor tyrosine kinase, autoinhibited, unphosphorylated, juxtamembrane, TRANSFERASE
Deposited on 2001-08-01, released 2001-10-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.231
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neural kinase, Nuk=Eph/Elk/Eck family receptor-like tyrosine kinase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54763
      • engineered (9)
      • engineered (15)
    Domains in SCOPe 2.03: d1jpaa_
  • Chain 'B':
    Compound: neural kinase, Nuk=Eph/Elk/Eck family receptor-like tyrosine kinase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54763
      • engineered (9)
      • engineered (15)
    Domains in SCOPe 2.03: d1jpab_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jpaA (A:)
    ghmtpgmkifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklpgkr
    eifvaiktlksgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengs
    ldsflrqndgqftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfg
    lsrfleddtsdptytsalggkipirwtapeaiqyrkftsasdvwsygivmwevmsygerp
    ywdmtnqdvinaieqdyrlpppmdcpsalhqlmldcwqkdrnhrpkfgqivntldkmirn
    pnslkamaplss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpaA (A:)
    kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklreifvaiktlk
    sgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrqndg
    qftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfpirwtapeaiq
    yrkftsasdvwsygivmwevmsygerpywdmtnqdvinaieqdyrlpppmdcpsalhqlm
    ldcwqkdrnhrpkfgqivntldkmirnpnslka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jpaB (B:)
    ghmtpgmkifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklpgkr
    eifvaiktlksgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengs
    ldsflrqndgqftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfg
    lsrfleddtsdptytsalggkipirwtapeaiqyrkftsasdvwsygivmwevmsygerp
    ywdmtnqdvinaieqdyrlpppmdcpsalhqlmldcwqkdrnhrpkfgqivntldkmirn
    pnslkamaplss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpaB (B:)
    kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlkreifvaiktlks
    gytekqrrdflseasimgqfdhpnvihlegvvtkspvmiitefmengsldsflrqndgqf
    tviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfpirwtapeaiqyr
    kftsasdvwsygivmwevmsygerpywdmtndvinaieqdyrlpppmdcpsalhqlmldc
    wqkdrnhrpkfgqivntldkmirnpnslk