PDB entry 1jp5

View 1jp5 on RCSB PDB site
Description:
Deposited on 2001-08-01, released 2001-10-12
The last revision prior to the SCOP 1.65 freeze date was dated 2001-10-12, with a file datestamp of 2001-10-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jp5a1, d1jp5a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jp5b1, d1jp5b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jp5A (A:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikggggsggg
    gsggggsevqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwint
    etdeptfaddfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqg
    ttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jp5A (A:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikevqlqqsg
    pelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptfaddfkgrf
    afsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jp5B (B:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikggggsggg
    gsggggsevqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwint
    etdeptfaddfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqg
    ttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jp5B (B:)
    dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleikevqlqqsg
    pelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptfaddfkgrf
    afsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss