PDB entry 1jos

View 1jos on RCSB PDB site
Description: Ribosome Binding Factor A(rbfA)
Class: RNA binding protein
Keywords: RNA BINDING PROTEIN, Structure 2 Function Project, S2F, Structural Genomics
Deposited on 2001-07-30, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome-binding factor a
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI1288
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1josa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1josA (A:)
    marefkrsdrvaqeiqkeiavilqrevkdprigmvtvsdvevssdlsyakifvtflfdhd
    emaieqgmkglekaspyirsllgkamrlrivpeirfiydqslvegmrmsnlvtnvvrede
    kkhveesn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1josA (A:)
    rsdrvaqeiqkeiavilqrevkdprigmvtvsdvevssdlsyakifvtflfdhdemaieq
    gmkglekaspyirsllgkamrlrivpeirfiydqslvegm