PDB entry 1joq

View 1joq on RCSB PDB site
Description: Ensemble structures for Staphylococcal nuclease-H124L in ternary complex with Ca2+ and thymidine-3',5'-bisphosphate
Class: hydrolase
Keywords: ternary complex, beta barrel, alpha helix, HYDROLASE
Deposited on 2001-07-30, released 2001-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-148)
      • engineered (123)
    Domains in SCOPe 2.08: d1joqa_
  • Heterogens: THP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1joqA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqllrkseaqakkeklniwsednadsgq