PDB entry 1jon

View 1jon on RCSB PDB site
Description: groEL (hsp60 class) fragment comprising residues 191-345
Class: chaperone
Keywords: chaperone, cell division, ATP-binding, phosphorylation
Deposited on 1996-05-30, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL, hsp60 class
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • engineered (71)
      • engineered (76)
    Domains in SCOPe 2.07: d1jona_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jonA (A:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
    katledlgqakrvvinkdtttiidgvgeeaaiqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jonA (A:)
    egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
    aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvimelekatle
    dlgqakrvvinkdtttiidgv